HORDB

General Information

ID: hor006062
Uniprot ID: Q99N14
Protein name: Hemokinin
Gene name: Tac4
Organism: Mus musculus (Mouse)
Family: Tachykinin family
Source: animal
Expression: Expressed in hematopoietic cells with highest levels in pre- and pro-B cells but not in later developmental stages. Also detected in uterus, skeletal muscle, brain, spleen, stomach, skin and lactating mammary gland and in cells of myeloid lineage includin
Disease: NA
Comments: NA
Taxonomy: Mus (subgenus), Mus (genus), Murinae (subfamily), Muridae (family), Muroidea , Myomorpha (suborder), Rodentia (order), Glires , Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
GO MF: GO:0005102 signaling receptor binding; GO:0031835 substance P receptor binding; GO:0031837 substance K receptor binding; GO:0048018 receptor ligand activity
GO BP: GO:0003085 negative regulation of systemic arterial blood pressure; GO:0006954 inflammatory response; GO:0007204 positive regulation of cytosolic calcium ion concentration; GO:0007217 tachykinin receptor signaling pathway; GO:0008217 regulation of blood pressure; GO:0043303 mast cell degranulation; GO:0046878 positive regulation of saliva secretion; GO:0050965 detection of temperature stimulus involved in sensory perception of pain; GO:0051930 regulation of sensory perception of pain; GO:1902093 positive regulation of flagellated sperm motility; GO:1904057 negative regulation of sensory perception of pain; GO:1904058 positive regulation of sensory perception of pain
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

Sequence: RSRTRQFYGLM
Length: 11
Propeptide: MLPLLALLLLIGPSVCTTAGDREELAFGAEAESWVTVNLKGIPVPSIELKLQELKRSRTRQFYGLMGKRVGGYQLGRIVQDLLGTRGLSIEGTCRQAASQQRARPGAVTRESLQSREEDEAPLTTSNV
Signal peptide: MLPLLALLLLIGPSVC
Modification: T11 Methionine amide
Glycosylation: NA
Mutagenesis: NA

Activity

Function: Tachykinins are active peptides which excite neurons, evoke behavioral responses, are potent vasodilators and secretagogues, and contract (directly or indirectly) many smooth muscles. Hemokinin induces plasma extravasation, mast cell degranulation, muscle contraction, salivary secretion and scratching behavior. Increases sperm motility. Induces potent analgesic effects and may play a role in pain modulation. Promotes survival of bone marrow B lineage cells and of cultured LPS-stimulated pre-B cells and may act as an autocrine factor required for B-cell survival and proliferation. Lowers systemic arterial pressure following intravenous injection. Induces interferon-gamma production and may play a role in the inflammatory response. Shows potent affinity and specificity for the NK-1 receptor.
Mechanism: NA
Cross BBB: NA
Target: Tacr1
Target Unid: P14600
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure

Disulfide bond: NA
Structure ID: AF-Q99N14-F1(AlphaFold_DB_ID)

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor006062_AF2.pdb

hor006062_ESM.pdb

Physical Information

Mass:	159318	Formula:	C61H99N21O16S
Absent amino acids:	ACDEHIKNPVW	Common amino acids:	R
pI:	12.2	Basic residues:	3
Polar residues:	4	Hydrophobic residues:	2
Hydrophobicity:	-106.36	Boman Index:	-4522
Half-Life:	1 hour	Half-Life Yeast:	2 min
Half-Life E.Coli:	2 min	Aliphatic Index	35.45
Instability Index:	9911.82	Extinction Coefficient cystines:	1490
Absorbance 280nm:	149

Literature

PubMed ID: 11062498
Title: Hemokinin is a hematopoietic-specific tachykinin that regulates B lymphopoiesis.
PubMed ID: 12716968
Title: Characterization of the endokinins: human tachykinins with cardiovascular activity.
PubMed ID: 19468303
Title: Lineage-specific biology revealed by a finished genome assembly of the mouse.
PubMed ID: 15489334
Title: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
PubMed ID: 11725292
Title: Hemokinin 1 is a full agonist at the substance P receptor.
PubMed ID: 11786503
Title: Pharmacological profile of the novel mammalian tachykinin, hemokinin 1.
PubMed ID: 12383518
Title: Identification, localization and receptor characterization of novel mammalian substance P-like peptides.
PubMed ID: 12044836
Title: Pharmacological profile of hemokinin 1: a novel member of the tachykinin family.
PubMed ID: 12842130
Title: Centrally administered hemokinin-1 (HK-1), a neurokinin NK1 receptor agonist, produces substance P-like behavioral effects in mice and gerbils.
PubMed ID: 15153465
Title: Cutting edge: hemokinin has substance P-like function and expression in inflammation.
PubMed ID: 15342200
Title: Expression of hemokinin 1 mRNA by murine dendritic cells.
PubMed ID: 15647454
Title: Functional and molecular characterization of tachykinins and tachykinin receptors in the mouse uterus.
PubMed ID: 16102736
Title: Effects and mechanisms of supraspinal administration of rat/mouse hemokinin-1, a mammalian tachykinin peptide, on nociception in mice.
PubMed ID: 17628523
Title: Cardiovascular responses to rat/mouse hemokinin-1, a mammalian tachykinin peptide: systemic study in anesthetized rats.