General Information

  • ID:  hor006062
  • Uniprot ID:  Q99N14
  • Protein name:  Hemokinin
  • Gene name:  Tac4
  • Organism:  Mus musculus (Mouse)
  • Family:  Tachykinin family
  • Source:  Animal
  • Expression:  Expressed in hematopoietic cells with highest levels in pre- and pro-B cells but not in later developmental stages. Also detected in uterus, skeletal muscle, brain, spleen, stomach, skin and lactating mammary gland and in cells of myeloid lineage includin
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Mus (subgenus), Mus (genus), Murinae (subfamily), Muridae (family), Muroidea , Myomorpha (suborder), Rodentia (order), Glires , Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005102 signaling receptor binding; GO:0031835 substance P receptor binding; GO:0031837 substance K receptor binding; GO:0048018 receptor ligand activity
  • GO BP:  GO:0003085 negative regulation of systemic arterial blood pressure; GO:0006954 inflammatory response; GO:0007204 positive regulation of cytosolic calcium ion concentration; GO:0007217 tachykinin receptor signaling pathway; GO:0008217 regulation of blood pressure; GO:0043303 mast cell degranulation; GO:0046878 positive regulation of saliva secretion; GO:0050965 detection of temperature stimulus involved in sensory perception of pain; GO:0051930 regulation of sensory perception of pain; GO:1902093 positive regulation of flagellated sperm motility; GO:1904057 negative regulation of sensory perception of pain; GO:1904058 positive regulation of sensory perception of pain
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  RSRTRQFYGLM
  • Length:  11(56-66)
  • Propeptide:  MLPLLALLLLIGPSVCTTAGDREELAFGAEAESWVTVNLKGIPVPSIELKLQELKRSRTRQFYGLMGKRVGGYQLGRIVQDLLGTRGLSIEGTCRQAASQQRARPGAVTRESLQSREEDEAPLTTSNV
  • Signal peptide:  MLPLLALLLLIGPSVC
  • Modification:  T11 Methionine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Tachykinins are active peptides which excite neurons, evoke behavioral responses, are potent vasodilators and secretagogues, and contract (directly or indirectly) many smooth muscles. Hemokinin induces plasma extravasation, mast cell degranulation, muscle
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  Tacr1
  • Target Unid:   P14600
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q99N14-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006062_AF2.pdbhor006062_ESM.pdb

Physical Information

Mass: 159318 Formula: C61H99N21O16S
Absent amino acids: ACDEHIKNPVW Common amino acids: R
pI: 12.2 Basic residues: 3
Polar residues: 4 Hydrophobic residues: 2
Hydrophobicity: -106.36 Boman Index: -4522
Half-Life / Aliphatic Index: 1 hour Aliphatic Index: 35.45
Instability Index: 9911.82 Extinction Coefficient cystines: 1490
Absorbance 280nm: 149

Literature

  • PubMed ID:  11062498
  • Title:  Hemokinin is a hematopoietic-specific tachykinin that regulates B lymphopoiesis.
  • PubMed ID:  12716968
  • Title:  Characterization of the endokinins: human tachykinins with cardiovascular activity.
  • PubMed ID:  19468303
  • Title:  Lineage-specific biology revealed by a finished genome assembly of the mouse.
  • PubMed ID:  15489334
  • Title:  The statu
  • PubMed ID:  11725292
  • Title:  
  • PubMed ID:  11786503
  • Title:  
  • PubMed ID:  12383518
  • Title:  
  • PubMed ID:  12044836
  • Title:  
  • PubMed ID:  12842130
  • Title:  
  • PubMed ID:  15153465
  • Title:  
  • PubMed ID:  15342200
  • Title:  
  • PubMed ID:  15647454
  • Title:  
  • PubMed ID:  16102736
  • Title:  
  • PubMed ID:  17628523
  • Title: